Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520
  1. Avatar for Knoblerine 71. Knoblerine Lv 1 4 pts. 10,237
  2. Avatar for dbuske 72. dbuske Lv 1 4 pts. 10,225
  3. Avatar for vizhu2018 73. vizhu2018 Lv 1 4 pts. 10,216
  4. Avatar for stomjoh 74. stomjoh Lv 1 4 pts. 10,211
  5. Avatar for MrZanav 75. MrZanav Lv 1 3 pts. 10,209
  6. Avatar for benrh 76. benrh Lv 1 3 pts. 10,185
  7. Avatar for Arne Heessels 77. Arne Heessels Lv 1 3 pts. 10,173
  8. Avatar for ehhan2018 78. ehhan2018 Lv 1 3 pts. 10,171
  9. Avatar for frostschutz 79. frostschutz Lv 1 3 pts. 10,171
  10. Avatar for Squirrely 80. Squirrely Lv 1 2 pts. 10,147

Comments