Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520
  1. Avatar for Aminal88 81. Aminal88 Lv 1 2 pts. 10,122
  2. Avatar for cobaltteal 82. cobaltteal Lv 1 2 pts. 10,104
  3. Avatar for tjonesster 83. tjonesster Lv 1 2 pts. 10,080
  4. Avatar for harvardman 84. harvardman Lv 1 2 pts. 10,070
  5. Avatar for navn 85. navn Lv 1 2 pts. 10,064
  6. Avatar for rabamino12358 86. rabamino12358 Lv 1 2 pts. 10,059
  7. Avatar for rinze 87. rinze Lv 1 2 pts. 10,040
  8. Avatar for alwen 88. alwen Lv 1 2 pts. 10,036
  9. Avatar for ironchefnorse 89. ironchefnorse Lv 1 1 pt. 10,017
  10. Avatar for dougdoug_dougk 90. dougdoug_dougk Lv 1 1 pt. 10,014

Comments