Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,907
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 10,896
  3. Avatar for Contenders 3. Contenders 61 pts. 10,858
  4. Avatar for Go Science 4. Go Science 47 pts. 10,796
  5. Avatar for HMT heritage 5. HMT heritage 35 pts. 10,795
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,779
  7. Avatar for Void Crushers 7. Void Crushers 19 pts. 10,749
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 10,725
  9. Avatar for Russian team 9. Russian team 10 pts. 10,719
  10. Avatar for Marvin's bunch 10. Marvin's bunch 7 pts. 10,634

  1. Avatar for RyeSnake 111. RyeSnake Lv 1 1 pt. 9,628
  2. Avatar for 4030_18_Abdelaziz 112. 4030_18_Abdelaziz Lv 1 1 pt. 9,628
  3. Avatar for Altercomp 113. Altercomp Lv 1 1 pt. 9,583
  4. Avatar for ti_go_Mars 114. ti_go_Mars Lv 1 1 pt. 9,569
  5. Avatar for Angelita De Castro 115. Angelita De Castro Lv 1 1 pt. 9,557
  6. Avatar for Philippe_C 116. Philippe_C Lv 1 1 pt. 9,548
  7. Avatar for ManVsYard 117. ManVsYard Lv 1 1 pt. 9,533
  8. Avatar for Crossed Sticks 118. Crossed Sticks Lv 1 1 pt. 9,531
  9. Avatar for hajtogato 119. hajtogato Lv 1 1 pt. 9,513
  10. Avatar for Hellcat6 120. Hellcat6 Lv 1 1 pt. 9,501

Comments