Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,907
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 10,896
  3. Avatar for Contenders 3. Contenders 61 pts. 10,858
  4. Avatar for Go Science 4. Go Science 47 pts. 10,796
  5. Avatar for HMT heritage 5. HMT heritage 35 pts. 10,795
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,779
  7. Avatar for Void Crushers 7. Void Crushers 19 pts. 10,749
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 10,725
  9. Avatar for Russian team 9. Russian team 10 pts. 10,719
  10. Avatar for Marvin's bunch 10. Marvin's bunch 7 pts. 10,634
  1. Avatar for ac281201 131. ac281201 Lv 1 1 pt. 9,155
  2. Avatar for aspadistra 132. aspadistra Lv 1 1 pt. 9,109
  3. Avatar for lamoille 133. lamoille Lv 1 1 pt. 9,088
  4. Avatar for khendarg 134. khendarg Lv 1 1 pt. 9,062
  5. Avatar for versat82 135. versat82 Lv 1 1 pt. 9,041
  6. Avatar for SiPot2018 136. SiPot2018 Lv 1 1 pt. 9,019
  7. Avatar for Ele25 137. Ele25 Lv 1 1 pt. 8,552
  8. Avatar for bkoep 138. bkoep Lv 1 1 pt. 8,537
  9. Avatar for RockOn 139. RockOn Lv 1 1 pt. 7,793
  10. Avatar for liaolantian 140. liaolantian Lv 1 1 pt. 5,520

Comments