Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,174
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,532
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,346
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,973
  5. Avatar for DW 2020 15. DW 2020 1 pt. 7,929
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,540
  7. Avatar for Deleted group 17. Deleted group pts. 5,503
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 0
  1. Avatar for Hellcat6 101. Hellcat6 Lv 1 1 pt. 7,356
  2. Avatar for SapoPaleo 102. SapoPaleo Lv 1 1 pt. 7,185
  3. Avatar for frostschutz 103. frostschutz Lv 1 1 pt. 6,296
  4. Avatar for SiPot2018 104. SiPot2018 Lv 1 1 pt. 6,169
  5. Avatar for jdmclure 105. jdmclure Lv 1 1 pt. 6,158
  6. Avatar for 01010011111 106. 01010011111 Lv 1 1 pt. 5,954
  7. Avatar for doctaven 107. doctaven Lv 1 1 pt. 5,540
  8. Avatar for 4030_18_Abdelaziz 108. 4030_18_Abdelaziz Lv 1 1 pt. 5,503
  9. Avatar for Mao Mao 109. Mao Mao Lv 1 1 pt. 5,325
  10. Avatar for altejoh 110. altejoh Lv 1 1 pt. 5,093

Comments