Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups


  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,174
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,532
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,346
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,973
  5. Avatar for DW 2020 15. DW 2020 1 pt. 7,929
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,540
  7. Avatar for Deleted group 17. Deleted group pts. 5,503
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 0

  1. Avatar for heather-1 51. heather-1 Lv 1 8 pts. 8,999
  2. Avatar for jausmh 52. jausmh Lv 1 7 pts. 8,984
  3. Avatar for Vincera 53. Vincera Lv 1 7 pts. 8,906
  4. Avatar for harvardman 54. harvardman Lv 1 6 pts. 8,862
  5. Avatar for Sissue 55. Sissue Lv 1 6 pts. 8,811
  6. Avatar for poiuytrewq987 56. poiuytrewq987 Lv 1 5 pts. 8,798
  7. Avatar for johnmitch 57. johnmitch Lv 1 5 pts. 8,795
  8. Avatar for stomjoh 58. stomjoh Lv 1 5 pts. 8,740
  9. Avatar for Arne Heessels 59. Arne Heessels Lv 1 4 pts. 8,739
  10. Avatar for katling 60. katling Lv 1 4 pts. 8,733

Comments