1651: Revisiting Puzzle 114: Black Mamba
Closed since about 7 years ago
Novice Overall PredictionSummary
- Created
- March 20, 2019
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK
Top groups
Comments
GeologyJoel Lv 1
How do I play when the program gives an error message: Peer certificate cannot be authenticated with given CA certificates…
What's the protocol for solving this issue?
frood66 Lv 1
would we be right in assuming that the issues with in game and site scores will be sorted here shortly?
Or are we all wasting our time?
actiasluna Lv 1
still not working properly