Placeholder image of a protein
Icon representing a puzzle

1651: Revisiting Puzzle 114: Black Mamba

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,252
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 11,183
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 11,126
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,118
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 11,106
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 11,091
  7. Avatar for Go Science 7. Go Science 15 pts. 11,086
  8. Avatar for Contenders 8. Contenders 11 pts. 11,029
  9. Avatar for Russian team 9. Russian team 7 pts. 10,964
  10. Avatar for GENE 433 10. GENE 433 5 pts. 10,784
  1. Avatar for fpc 31. fpc Lv 1 30 pts. 10,869
  2. Avatar for Phyx 32. Phyx Lv 1 29 pts. 10,862
  3. Avatar for orily1337 33. orily1337 Lv 1 27 pts. 10,854
  4. Avatar for Deleted player 34. Deleted player 26 pts. 10,849
  5. Avatar for WBarme1234 35. WBarme1234 Lv 1 25 pts. 10,837
  6. Avatar for tarimo 36. tarimo Lv 1 24 pts. 10,831
  7. Avatar for jermainiac 37. jermainiac Lv 1 23 pts. 10,825
  8. Avatar for manu8170 38. manu8170 Lv 1 21 pts. 10,805
  9. Avatar for Crossed Sticks 39. Crossed Sticks Lv 1 20 pts. 10,792
  10. Avatar for guineapig 40. guineapig Lv 1 20 pts. 10,791

Comments

GeologyJoel Lv 1

How do I play when the program gives an error message: Peer certificate cannot be authenticated with given CA certificates…

What's the protocol for solving this issue?

frood66 Lv 1

would we be right in assuming that the issues with in game and site scores will be sorted here shortly?

Or are we all wasting our time?