Placeholder image of a protein
Icon representing a puzzle

1651: Revisiting Puzzle 114: Black Mamba

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
March 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 10,744
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,651
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 9,880
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,827
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,768
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,756
  7. Avatar for freefolder 17. freefolder 1 pt. 9,516
  8. Avatar for SHELL 18. SHELL 1 pt. 9,172
  9. Avatar for I3L GANG 19. I3L GANG 1 pt. 9,130
  10. Avatar for Dr. B Orgo 2 20. Dr. B Orgo 2 1 pt. 8,563

  1. Avatar for Marvelz 41. Marvelz Lv 1 19 pts. 10,784
  2. Avatar for Cagdason 42. Cagdason Lv 1 18 pts. 10,784
  3. Avatar for Idiotboy 43. Idiotboy Lv 1 17 pts. 10,744
  4. Avatar for Aminal88 44. Aminal88 Lv 1 16 pts. 10,744
  5. Avatar for Glen B 45. Glen B Lv 1 15 pts. 10,726
  6. Avatar for pvc78 46. pvc78 Lv 1 14 pts. 10,722
  7. Avatar for gdnskye 47. gdnskye Lv 1 14 pts. 10,705
  8. Avatar for alwen 48. alwen Lv 1 13 pts. 10,689
  9. Avatar for stomjoh 49. stomjoh Lv 1 12 pts. 10,685
  10. Avatar for Vinara 50. Vinara Lv 1 12 pts. 10,679

Comments


GeologyJoel Lv 1

How do I play when the program gives an error message: Peer certificate cannot be authenticated with given CA certificates…

What's the protocol for solving this issue?

frood66 Lv 1

would we be right in assuming that the issues with in game and site scores will be sorted here shortly?

Or are we all wasting our time?