Placeholder image of a protein
Icon representing a puzzle

1651: Revisiting Puzzle 114: Black Mamba

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,252
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 11,183
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 11,126
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,118
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 11,106
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 11,091
  7. Avatar for Go Science 7. Go Science 15 pts. 11,086
  8. Avatar for Contenders 8. Contenders 11 pts. 11,029
  9. Avatar for Russian team 9. Russian team 7 pts. 10,964
  10. Avatar for GENE 433 10. GENE 433 5 pts. 10,784
  1. Avatar for Marvelz 41. Marvelz Lv 1 19 pts. 10,784
  2. Avatar for Cagdason 42. Cagdason Lv 1 18 pts. 10,784
  3. Avatar for Idiotboy 43. Idiotboy Lv 1 17 pts. 10,744
  4. Avatar for Aminal88 44. Aminal88 Lv 1 16 pts. 10,744
  5. Avatar for Glen B 45. Glen B Lv 1 15 pts. 10,726
  6. Avatar for pvc78 46. pvc78 Lv 1 14 pts. 10,722
  7. Avatar for gdnskye 47. gdnskye Lv 1 14 pts. 10,705
  8. Avatar for alwen 48. alwen Lv 1 13 pts. 10,689
  9. Avatar for stomjoh 49. stomjoh Lv 1 12 pts. 10,685
  10. Avatar for Vinara 50. Vinara Lv 1 12 pts. 10,679

Comments

GeologyJoel Lv 1

How do I play when the program gives an error message: Peer certificate cannot be authenticated with given CA certificates…

What's the protocol for solving this issue?

frood66 Lv 1

would we be right in assuming that the issues with in game and site scores will be sorted here shortly?

Or are we all wasting our time?