Placeholder image of a protein
Icon representing a puzzle

1651: Revisiting Puzzle 114: Black Mamba

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,252
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 11,183
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 11,126
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,118
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 11,106
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 11,091
  7. Avatar for Go Science 7. Go Science 15 pts. 11,086
  8. Avatar for Contenders 8. Contenders 11 pts. 11,029
  9. Avatar for Russian team 9. Russian team 7 pts. 10,964
  10. Avatar for GENE 433 10. GENE 433 5 pts. 10,784
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 69 pts. 11,072
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 67 pts. 11,060
  3. Avatar for tyler0911 13. tyler0911 Lv 1 64 pts. 11,030
  4. Avatar for crpainter 14. crpainter Lv 1 61 pts. 11,029
  5. Avatar for johnmitch 15. johnmitch Lv 1 59 pts. 11,009
  6. Avatar for georg137 16. georg137 Lv 1 57 pts. 11,005
  7. Avatar for grogar7 17. grogar7 Lv 1 55 pts. 10,993
  8. Avatar for MicElephant 18. MicElephant Lv 1 52 pts. 10,990
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 50 pts. 10,986
  10. Avatar for reefyrob 20. reefyrob Lv 1 48 pts. 10,981

Comments

GeologyJoel Lv 1

How do I play when the program gives an error message: Peer certificate cannot be authenticated with given CA certificates…

What's the protocol for solving this issue?

frood66 Lv 1

would we be right in assuming that the issues with in game and site scores will be sorted here shortly?

Or are we all wasting our time?