Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208

  1. Avatar for ti_go_Mars 101. ti_go_Mars Lv 1 1 pt. 9,791
  2. Avatar for Altercomp 102. Altercomp Lv 1 1 pt. 9,754
  3. Avatar for vizhu2018 103. vizhu2018 Lv 1 1 pt. 9,749
  4. Avatar for Hellcat6 104. Hellcat6 Lv 1 1 pt. 9,743
  5. Avatar for MrZanav 105. MrZanav Lv 1 1 pt. 9,719
  6. Avatar for Cagdason 106. Cagdason Lv 1 1 pt. 9,718
  7. Avatar for lostdk 107. lostdk Lv 1 1 pt. 9,702
  8. Avatar for rinze 108. rinze Lv 1 1 pt. 9,626
  9. Avatar for memam2018 109. memam2018 Lv 1 1 pt. 9,617
  10. Avatar for Philippe_C 110. Philippe_C Lv 1 1 pt. 9,606

Comments