Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,133
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 11,061
  3. Avatar for Go Science 3. Go Science 56 pts. 11,020
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 11,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 10,986
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 10,917
  7. Avatar for Hold My Beer 7. Hold My Beer 14 pts. 10,909
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,877
  9. Avatar for Russian team 9. Russian team 6 pts. 10,864
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,858
  1. Avatar for ti_go_Mars 101. ti_go_Mars Lv 1 1 pt. 9,791
  2. Avatar for Altercomp 102. Altercomp Lv 1 1 pt. 9,754
  3. Avatar for vizhu2018 103. vizhu2018 Lv 1 1 pt. 9,749
  4. Avatar for Hellcat6 104. Hellcat6 Lv 1 1 pt. 9,743
  5. Avatar for MrZanav 105. MrZanav Lv 1 1 pt. 9,719
  6. Avatar for Cagdason 106. Cagdason Lv 1 1 pt. 9,718
  7. Avatar for lostdk 107. lostdk Lv 1 1 pt. 9,702
  8. Avatar for rinze 108. rinze Lv 1 1 pt. 9,626
  9. Avatar for memam2018 109. memam2018 Lv 1 1 pt. 9,617
  10. Avatar for Philippe_C 110. Philippe_C Lv 1 1 pt. 9,606

Comments