Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208

  1. Avatar for navn 121. navn Lv 1 1 pt. 9,437
  2. Avatar for Bithalbierer 122. Bithalbierer Lv 1 1 pt. 9,373
  3. Avatar for mberna00 123. mberna00 Lv 1 1 pt. 9,364
  4. Avatar for sir benn 124. sir benn Lv 1 1 pt. 9,342
  5. Avatar for wozzarelli 125. wozzarelli Lv 1 1 pt. 9,320
  6. Avatar for abhxyz 126. abhxyz Lv 1 1 pt. 9,297
  7. Avatar for Vincera 127. Vincera Lv 1 1 pt. 9,290
  8. Avatar for cenkonur 128. cenkonur Lv 1 1 pt. 9,232
  9. Avatar for katling 129. katling Lv 1 1 pt. 9,215
  10. Avatar for doctaven 130. doctaven Lv 1 1 pt. 9,208

Comments