Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,133
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 11,061
  3. Avatar for Go Science 3. Go Science 56 pts. 11,020
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 11,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 10,986
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 10,917
  7. Avatar for Hold My Beer 7. Hold My Beer 14 pts. 10,909
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,877
  9. Avatar for Russian team 9. Russian team 6 pts. 10,864
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,858
  1. Avatar for navn 121. navn Lv 1 1 pt. 9,437
  2. Avatar for Bithalbierer 122. Bithalbierer Lv 1 1 pt. 9,373
  3. Avatar for mberna00 123. mberna00 Lv 1 1 pt. 9,364
  4. Avatar for sir benn 124. sir benn Lv 1 1 pt. 9,342
  5. Avatar for wozzarelli 125. wozzarelli Lv 1 1 pt. 9,320
  6. Avatar for abhxyz 126. abhxyz Lv 1 1 pt. 9,297
  7. Avatar for Vincera 127. Vincera Lv 1 1 pt. 9,290
  8. Avatar for cenkonur 128. cenkonur Lv 1 1 pt. 9,232
  9. Avatar for katling 129. katling Lv 1 1 pt. 9,215
  10. Avatar for doctaven 130. doctaven Lv 1 1 pt. 9,208

Comments