Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 3 pts. 9,979
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,662
  3. Avatar for freefolder 13. freefolder 1 pt. 9,657
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,591
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 9,421
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,123
  7. Avatar for NECC Anatomy and Physiology 17. NECC Anatomy and Physiology 1 pt. 6,388
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,226
  9. Avatar for MBB190 19. MBB190 1 pt. 6,131
  10. Avatar for Window Group 20. Window Group 1 pt. 0
  1. Avatar for SiPot2018 131. SiPot2018 Lv 1 1 pt. 6,735
  2. Avatar for mattj256 132. mattj256 Lv 1 1 pt. 6,515
  3. Avatar for link101 133. link101 Lv 1 1 pt. 6,494
  4. Avatar for komnor 134. komnor Lv 1 1 pt. 6,451
  5. Avatar for CoONe2019 135. CoONe2019 Lv 1 1 pt. 6,388
  6. Avatar for aspadistra 136. aspadistra Lv 1 1 pt. 6,226
  7. Avatar for ti_go_Mars 137. ti_go_Mars Lv 1 1 pt. 6,195
  8. Avatar for regpunzalan 138. regpunzalan Lv 1 1 pt. 6,131
  9. Avatar for shuyangli 139. shuyangli Lv 1 1 pt. 6,114
  10. Avatar for saphira 140. saphira Lv 1 1 pt. 5,932

Comments