Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups


  1. Avatar for Beta Folders 100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992

  1. Avatar for SiPot2018 131. SiPot2018 Lv 1 1 pt. 6,735
  2. Avatar for mattj256 132. mattj256 Lv 1 1 pt. 6,515
  3. Avatar for link101 133. link101 Lv 1 1 pt. 6,494
  4. Avatar for komnor 134. komnor Lv 1 1 pt. 6,451
  5. Avatar for CoONe2019 135. CoONe2019 Lv 1 1 pt. 6,388
  6. Avatar for aspadistra 136. aspadistra Lv 1 1 pt. 6,226
  7. Avatar for ti_go_Mars 137. ti_go_Mars Lv 1 1 pt. 6,195
  8. Avatar for regpunzalan 138. regpunzalan Lv 1 1 pt. 6,131
  9. Avatar for shuyangli 139. shuyangli Lv 1 1 pt. 6,114
  10. Avatar for saphira 140. saphira Lv 1 1 pt. 5,932

Comments