Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 3 pts. 9,979
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,662
  3. Avatar for freefolder 13. freefolder 1 pt. 9,657
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,591
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 9,421
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,123
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,226
  8. Avatar for MBB190 19. MBB190 1 pt. 6,131
  9. Avatar for Window Group 20. Window Group 1 pt. 0

  1. Avatar for pvc78 21. pvc78 Lv 1 48 pts. 10,244
  2. Avatar for vakobo 22. vakobo Lv 1 47 pts. 10,241
  3. Avatar for fpc 23. fpc Lv 1 45 pts. 10,240
  4. Avatar for monteecristo 24. monteecristo Lv 1 43 pts. 10,238
  5. Avatar for robgee 25. robgee Lv 1 41 pts. 10,237
  6. Avatar for Deleted player 26. Deleted player pts. 10,234
  7. Avatar for silent gene 27. silent gene Lv 1 38 pts. 10,232
  8. Avatar for georg137 28. georg137 Lv 1 36 pts. 10,223
  9. Avatar for Marvelz 29. Marvelz Lv 1 35 pts. 10,219
  10. Avatar for phi16 30. phi16 Lv 1 34 pts. 10,198

Comments