Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for pvc78 21. pvc78 Lv 1 48 pts. 10,244
  2. Avatar for vakobo 22. vakobo Lv 1 47 pts. 10,241
  3. Avatar for fpc 23. fpc Lv 1 45 pts. 10,240
  4. Avatar for monteecristo 24. monteecristo Lv 1 43 pts. 10,238
  5. Avatar for robgee 25. robgee Lv 1 41 pts. 10,237
  6. Avatar for Deleted player 26. Deleted player pts. 10,234
  7. Avatar for silent gene 27. silent gene Lv 1 38 pts. 10,232
  8. Avatar for georg137 28. georg137 Lv 1 36 pts. 10,223
  9. Avatar for Marvelz 29. Marvelz Lv 1 35 pts. 10,219
  10. Avatar for phi16 30. phi16 Lv 1 34 pts. 10,198

Comments