Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 3 pts. 9,979
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,662
  3. Avatar for freefolder 13. freefolder 1 pt. 9,657
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,591
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 9,421
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,123
  7. Avatar for NECC Anatomy and Physiology 17. NECC Anatomy and Physiology 1 pt. 6,388
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,226
  9. Avatar for MBB190 19. MBB190 1 pt. 6,131
  10. Avatar for Window Group 20. Window Group 1 pt. 0
  1. Avatar for johnmitch 31. johnmitch Lv 1 32 pts. 10,173
  2. Avatar for NinjaGreg 32. NinjaGreg Lv 1 31 pts. 10,163
  3. Avatar for tyler0911 33. tyler0911 Lv 1 30 pts. 10,152
  4. Avatar for jermainiac 34. jermainiac Lv 1 28 pts. 10,149
  5. Avatar for aznarog 35. aznarog Lv 1 27 pts. 10,149
  6. Avatar for christioanchauvin 36. christioanchauvin Lv 1 26 pts. 10,141
  7. Avatar for joremen 37. joremen Lv 1 25 pts. 10,136
  8. Avatar for timroberts16 38. timroberts16 Lv 1 24 pts. 10,135
  9. Avatar for Aminal88 39. Aminal88 Lv 1 23 pts. 10,133
  10. Avatar for alwen 40. alwen Lv 1 22 pts. 10,109

Comments