Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for johnmitch 31. johnmitch Lv 1 32 pts. 10,173
  2. Avatar for NinjaGreg 32. NinjaGreg Lv 1 31 pts. 10,163
  3. Avatar for tyler0911 33. tyler0911 Lv 1 30 pts. 10,152
  4. Avatar for jermainiac 34. jermainiac Lv 1 28 pts. 10,149
  5. Avatar for aznarog 35. aznarog Lv 1 27 pts. 10,149
  6. Avatar for christioanchauvin 36. christioanchauvin Lv 1 26 pts. 10,141
  7. Avatar for joremen 37. joremen Lv 1 25 pts. 10,136
  8. Avatar for timroberts16 38. timroberts16 Lv 1 24 pts. 10,135
  9. Avatar for Aminal88 39. Aminal88 Lv 1 23 pts. 10,133
  10. Avatar for alwen 40. alwen Lv 1 22 pts. 10,109

Comments