Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 3 pts. 9,979
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,662
  3. Avatar for freefolder 13. freefolder 1 pt. 9,657
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,591
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 9,421
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,123
  7. Avatar for NECC Anatomy and Physiology 17. NECC Anatomy and Physiology 1 pt. 6,388
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,226
  9. Avatar for MBB190 19. MBB190 1 pt. 6,131
  10. Avatar for Window Group 20. Window Group 1 pt. 0
  1. Avatar for nicobul 41. nicobul Lv 1 21 pts. 10,105
  2. Avatar for O Seki To 42. O Seki To Lv 1 20 pts. 10,090
  3. Avatar for hansvandenhof 43. hansvandenhof Lv 1 19 pts. 10,079
  4. Avatar for manu8170 44. manu8170 Lv 1 18 pts. 10,077
  5. Avatar for Vinara 45. Vinara Lv 1 17 pts. 10,069
  6. Avatar for jobo0502 46. jobo0502 Lv 1 16 pts. 10,053
  7. Avatar for guineapig 47. guineapig Lv 1 16 pts. 10,019
  8. Avatar for YeshuaLives 48. YeshuaLives Lv 1 15 pts. 10,018
  9. Avatar for Sissue 49. Sissue Lv 1 14 pts. 10,003
  10. Avatar for Museka 50. Museka Lv 1 13 pts. 9,996

Comments