Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for nicobul 41. nicobul Lv 1 21 pts. 10,105
  2. Avatar for O Seki To 42. O Seki To Lv 1 20 pts. 10,090
  3. Avatar for hansvandenhof 43. hansvandenhof Lv 1 19 pts. 10,079
  4. Avatar for manu8170 44. manu8170 Lv 1 18 pts. 10,077
  5. Avatar for Vinara 45. Vinara Lv 1 17 pts. 10,069
  6. Avatar for jobo0502 46. jobo0502 Lv 1 16 pts. 10,053
  7. Avatar for guineapig 47. guineapig Lv 1 16 pts. 10,019
  8. Avatar for YeshuaLives 48. YeshuaLives Lv 1 15 pts. 10,018
  9. Avatar for Sissue 49. Sissue Lv 1 14 pts. 10,003
  10. Avatar for Museka 50. Museka Lv 1 13 pts. 9,996

Comments