Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 3 pts. 9,979
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,662
  3. Avatar for freefolder 13. freefolder 1 pt. 9,657
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,591
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 9,421
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,123
  7. Avatar for NECC Anatomy and Physiology 17. NECC Anatomy and Physiology 1 pt. 6,388
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,226
  9. Avatar for MBB190 19. MBB190 1 pt. 6,131
  10. Avatar for Window Group 20. Window Group 1 pt. 0
  1. Avatar for jausmh 51. jausmh Lv 1 13 pts. 9,992
  2. Avatar for cbwest 52. cbwest Lv 1 12 pts. 9,991
  3. Avatar for frood66 53. frood66 Lv 1 12 pts. 9,986
  4. Avatar for Timo van der Laan 54. Timo van der Laan Lv 1 11 pts. 9,979
  5. Avatar for heather-1 55. heather-1 Lv 1 10 pts. 9,962
  6. Avatar for WBarme1234 56. WBarme1234 Lv 1 10 pts. 9,943
  7. Avatar for Mike Cassidy 57. Mike Cassidy Lv 1 9 pts. 9,936
  8. Avatar for benrh 58. benrh Lv 1 9 pts. 9,914
  9. Avatar for alcor29 59. alcor29 Lv 1 8 pts. 9,897
  10. Avatar for diamonddays 60. diamonddays Lv 1 8 pts. 9,883

Comments