Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for jausmh 51. jausmh Lv 1 13 pts. 9,992
  2. Avatar for cbwest 52. cbwest Lv 1 12 pts. 9,991
  3. Avatar for frood66 53. frood66 Lv 1 12 pts. 9,986
  4. Avatar for Timo van der Laan 54. Timo van der Laan Lv 1 11 pts. 9,979
  5. Avatar for heather-1 55. heather-1 Lv 1 10 pts. 9,962
  6. Avatar for WBarme1234 56. WBarme1234 Lv 1 10 pts. 9,943
  7. Avatar for Mike Cassidy 57. Mike Cassidy Lv 1 9 pts. 9,936
  8. Avatar for benrh 58. benrh Lv 1 9 pts. 9,914
  9. Avatar for alcor29 59. alcor29 Lv 1 8 pts. 9,897
  10. Avatar for diamonddays 60. diamonddays Lv 1 8 pts. 9,883

Comments