Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 3 pts. 9,979
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,662
  3. Avatar for freefolder 13. freefolder 1 pt. 9,657
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,591
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 9,421
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,123
  7. Avatar for NECC Anatomy and Physiology 17. NECC Anatomy and Physiology 1 pt. 6,388
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,226
  9. Avatar for MBB190 19. MBB190 1 pt. 6,131
  10. Avatar for Window Group 20. Window Group 1 pt. 0
  1. Avatar for stomjoh 61. stomjoh Lv 1 8 pts. 9,880
  2. Avatar for orily1337 62. orily1337 Lv 1 7 pts. 9,863
  3. Avatar for rezaefar 63. rezaefar Lv 1 7 pts. 9,858
  4. Avatar for Arne Heessels 64. Arne Heessels Lv 1 6 pts. 9,854
  5. Avatar for Merf 65. Merf Lv 1 6 pts. 9,843
  6. Avatar for abiogenesis 66. abiogenesis Lv 1 6 pts. 9,830
  7. Avatar for RockOn 67. RockOn Lv 1 5 pts. 9,821
  8. Avatar for YGK 68. YGK Lv 1 5 pts. 9,814
  9. Avatar for Bautho 69. Bautho Lv 1 5 pts. 9,789
  10. Avatar for tarimo 70. tarimo Lv 1 5 pts. 9,785

Comments