Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for stomjoh 61. stomjoh Lv 1 8 pts. 9,880
  2. Avatar for orily1337 62. orily1337 Lv 1 7 pts. 9,863
  3. Avatar for rezaefar 63. rezaefar Lv 1 7 pts. 9,858
  4. Avatar for Arne Heessels 64. Arne Heessels Lv 1 6 pts. 9,854
  5. Avatar for Merf 65. Merf Lv 1 6 pts. 9,843
  6. Avatar for abiogenesis 66. abiogenesis Lv 1 6 pts. 9,830
  7. Avatar for RockOn 67. RockOn Lv 1 5 pts. 9,821
  8. Avatar for YGK 68. YGK Lv 1 5 pts. 9,814
  9. Avatar for Bautho 69. Bautho Lv 1 5 pts. 9,789
  10. Avatar for tarimo 70. tarimo Lv 1 5 pts. 9,785

Comments