Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 3 pts. 9,979
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,662
  3. Avatar for freefolder 13. freefolder 1 pt. 9,657
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,591
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 9,421
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,123
  7. Avatar for NECC Anatomy and Physiology 17. NECC Anatomy and Physiology 1 pt. 6,388
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,226
  9. Avatar for MBB190 19. MBB190 1 pt. 6,131
  10. Avatar for Window Group 20. Window Group 1 pt. 0
  1. Avatar for Dhalion 71. Dhalion Lv 1 4 pts. 9,771
  2. Avatar for pfirth 72. pfirth Lv 1 4 pts. 9,768
  3. Avatar for poiuytrewq987 73. poiuytrewq987 Lv 1 4 pts. 9,743
  4. Avatar for harvardman 74. harvardman Lv 1 4 pts. 9,715
  5. Avatar for rabamino12358 75. rabamino12358 Lv 1 3 pts. 9,695
  6. Avatar for Petrifolder 76. Petrifolder Lv 1 3 pts. 9,666
  7. Avatar for SWR_DMaster 77. SWR_DMaster Lv 1 3 pts. 9,664
  8. Avatar for Cagdason 78. Cagdason Lv 1 3 pts. 9,662
  9. Avatar for Altercomp 79. Altercomp Lv 1 3 pts. 9,657
  10. Avatar for MicElephant 80. MicElephant Lv 1 3 pts. 9,655

Comments