Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for Dhalion 71. Dhalion Lv 1 4 pts. 9,771
  2. Avatar for pfirth 72. pfirth Lv 1 4 pts. 9,768
  3. Avatar for poiuytrewq987 73. poiuytrewq987 Lv 1 4 pts. 9,743
  4. Avatar for harvardman 74. harvardman Lv 1 4 pts. 9,715
  5. Avatar for rabamino12358 75. rabamino12358 Lv 1 3 pts. 9,695
  6. Avatar for Petrifolder 76. Petrifolder Lv 1 3 pts. 9,666
  7. Avatar for SWR_DMaster 77. SWR_DMaster Lv 1 3 pts. 9,664
  8. Avatar for Cagdason 78. Cagdason Lv 1 3 pts. 9,662
  9. Avatar for Altercomp 79. Altercomp Lv 1 3 pts. 9,657
  10. Avatar for MicElephant 80. MicElephant Lv 1 3 pts. 9,655

Comments