Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 3 pts. 9,979
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,662
  3. Avatar for freefolder 13. freefolder 1 pt. 9,657
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,591
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 9,421
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,123
  7. Avatar for NECC Anatomy and Physiology 17. NECC Anatomy and Physiology 1 pt. 6,388
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,226
  9. Avatar for MBB190 19. MBB190 1 pt. 6,131
  10. Avatar for Window Group 20. Window Group 1 pt. 0
  1. Avatar for Hugeen 81. Hugeen Lv 1 2 pts. 9,640
  2. Avatar for DoctorSockrates 82. DoctorSockrates Lv 1 2 pts. 9,628
  3. Avatar for boondog 83. boondog Lv 1 2 pts. 9,623
  4. Avatar for Maerlyn138 84. Maerlyn138 Lv 1 2 pts. 9,605
  5. Avatar for oureion 85. oureion Lv 1 2 pts. 9,591
  6. Avatar for Vincera 86. Vincera Lv 1 2 pts. 9,586
  7. Avatar for Alpha-KetoGlutarate1301 87. Alpha-KetoGlutarate1301 Lv 1 2 pts. 9,577
  8. Avatar for MrZanav 88. MrZanav Lv 1 2 pts. 9,573
  9. Avatar for jdmclure 89. jdmclure Lv 1 1 pt. 9,557
  10. Avatar for Squirrely 90. Squirrely Lv 1 1 pt. 9,541

Comments