Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for Hugeen 81. Hugeen Lv 1 2 pts. 9,640
  2. Avatar for DoctorSockrates 82. DoctorSockrates Lv 1 2 pts. 9,628
  3. Avatar for boondog 83. boondog Lv 1 2 pts. 9,623
  4. Avatar for Maerlyn138 84. Maerlyn138 Lv 1 2 pts. 9,605
  5. Avatar for oureion 85. oureion Lv 1 2 pts. 9,591
  6. Avatar for Vincera 86. Vincera Lv 1 2 pts. 9,586
  7. Avatar for Alpha-KetoGlutarate1301 87. Alpha-KetoGlutarate1301 Lv 1 2 pts. 9,577
  8. Avatar for MrZanav 88. MrZanav Lv 1 2 pts. 9,573
  9. Avatar for jdmclure 89. jdmclure Lv 1 1 pt. 9,557
  10. Avatar for Squirrely 90. Squirrely Lv 1 1 pt. 9,541

Comments