Placeholder image of a protein
Icon representing a puzzle

1657: Unsolved De-novo Freestyle 150

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,651
  2. Avatar for Contenders 2. Contenders 77 pts. 10,533
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 10,480
  4. Avatar for Go Science 4. Go Science 43 pts. 10,480
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,379
  6. Avatar for Hold My Beer 6. Hold My Beer 22 pts. 10,260
  7. Avatar for Russian team 7. Russian team 15 pts. 10,241
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 10,149
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,090
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 9,992
  1. Avatar for ourtown 121. ourtown Lv 1 1 pt. 8,793
  2. Avatar for Sunmurder 122. Sunmurder Lv 1 1 pt. 8,614
  3. Avatar for ehhan2018 123. ehhan2018 Lv 1 1 pt. 8,536
  4. Avatar for xbp 124. xbp Lv 1 1 pt. 7,952
  5. Avatar for altejoh 125. altejoh Lv 1 1 pt. 7,806
  6. Avatar for Gandook 126. Gandook Lv 1 1 pt. 7,515
  7. Avatar for carsonfb 127. carsonfb Lv 1 1 pt. 7,511
  8. Avatar for Wilmerst23 128. Wilmerst23 Lv 1 1 pt. 7,428
  9. Avatar for cenkonur 129. cenkonur Lv 1 1 pt. 7,359
  10. Avatar for h1psta 130. h1psta Lv 1 1 pt. 6,856

Comments