Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,684
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 10,518
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,400
  4. Avatar for freefolder 14. freefolder 1 pt. 10,199
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,091
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,913
  7. Avatar for I3L GANG 17. I3L GANG 1 pt. 9,484
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 9,425
  9. Avatar for GENE 433 19. GENE 433 1 pt. 9,310
  1. Avatar for Zainul0103 101. Zainul0103 Lv 1 1 pt. 9,484
  2. Avatar for hajtogato 102. hajtogato Lv 1 1 pt. 9,451
  3. Avatar for benz888 103. benz888 Lv 1 1 pt. 9,448
  4. Avatar for junsuha 104. junsuha Lv 1 1 pt. 9,448
  5. Avatar for lconor 105. lconor Lv 1 1 pt. 9,436
  6. Avatar for oureion 106. oureion Lv 1 1 pt. 9,425
  7. Avatar for janikavillamor 107. janikavillamor Lv 1 1 pt. 9,417
  8. Avatar for jdmclure 108. jdmclure Lv 1 1 pt. 9,409
  9. Avatar for Knoblerine 109. Knoblerine Lv 1 1 pt. 9,397
  10. Avatar for navn 110. navn Lv 1 1 pt. 9,385

Comments