Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697
  1. Avatar for Zainul0103 101. Zainul0103 Lv 1 1 pt. 9,484
  2. Avatar for hajtogato 102. hajtogato Lv 1 1 pt. 9,451
  3. Avatar for benz888 103. benz888 Lv 1 1 pt. 9,448
  4. Avatar for junsuha 104. junsuha Lv 1 1 pt. 9,448
  5. Avatar for lconor 105. lconor Lv 1 1 pt. 9,436
  6. Avatar for oureion 106. oureion Lv 1 1 pt. 9,425
  7. Avatar for janikavillamor 107. janikavillamor Lv 1 1 pt. 9,417
  8. Avatar for jdmclure 108. jdmclure Lv 1 1 pt. 9,409
  9. Avatar for Knoblerine 109. Knoblerine Lv 1 1 pt. 9,397
  10. Avatar for navn 110. navn Lv 1 1 pt. 9,385

Comments