Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,684
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 10,518
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,400
  4. Avatar for freefolder 14. freefolder 1 pt. 10,199
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,091
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,913
  7. Avatar for I3L GANG 17. I3L GANG 1 pt. 9,484
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 9,425
  9. Avatar for GENE 433 19. GENE 433 1 pt. 9,310
  1. Avatar for actiasluna 21. actiasluna Lv 1 44 pts. 10,734
  2. Avatar for vakobo 22. vakobo Lv 1 42 pts. 10,727
  3. Avatar for Timo van der Laan 23. Timo van der Laan Lv 1 40 pts. 10,718
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 38 pts. 10,711
  5. Avatar for jausmh 25. jausmh Lv 1 36 pts. 10,697
  6. Avatar for YeshuaLives 26. YeshuaLives Lv 1 35 pts. 10,693
  7. Avatar for georg137 27. georg137 Lv 1 33 pts. 10,692
  8. Avatar for Hiro Protagonist 28. Hiro Protagonist Lv 1 31 pts. 10,684
  9. Avatar for jermainiac 29. jermainiac Lv 1 30 pts. 10,671
  10. Avatar for Blipperman 30. Blipperman Lv 1 28 pts. 10,665

Comments