Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697
  1. Avatar for actiasluna 21. actiasluna Lv 1 44 pts. 10,734
  2. Avatar for vakobo 22. vakobo Lv 1 42 pts. 10,727
  3. Avatar for Timo van der Laan 23. Timo van der Laan Lv 1 40 pts. 10,718
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 38 pts. 10,711
  5. Avatar for jausmh 25. jausmh Lv 1 36 pts. 10,697
  6. Avatar for YeshuaLives 26. YeshuaLives Lv 1 35 pts. 10,693
  7. Avatar for georg137 27. georg137 Lv 1 33 pts. 10,692
  8. Avatar for Hiro Protagonist 28. Hiro Protagonist Lv 1 31 pts. 10,684
  9. Avatar for jermainiac 29. jermainiac Lv 1 30 pts. 10,671
  10. Avatar for Blipperman 30. Blipperman Lv 1 28 pts. 10,665

Comments