Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,684
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 10,518
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,400
  4. Avatar for freefolder 14. freefolder 1 pt. 10,199
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,091
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,913
  7. Avatar for I3L GANG 17. I3L GANG 1 pt. 9,484
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 9,425
  9. Avatar for GENE 433 19. GENE 433 1 pt. 9,310
  1. Avatar for cobaltteal 31. cobaltteal Lv 1 27 pts. 10,663
  2. Avatar for Museka 32. Museka Lv 1 26 pts. 10,652
  3. Avatar for joremen 33. joremen Lv 1 25 pts. 10,648
  4. Avatar for MicElephant 34. MicElephant Lv 1 23 pts. 10,640
  5. Avatar for frood66 35. frood66 Lv 1 22 pts. 10,631
  6. Avatar for TastyMunchies 36. TastyMunchies Lv 1 21 pts. 10,630
  7. Avatar for Simek 37. Simek Lv 1 20 pts. 10,616
  8. Avatar for Deleted player 38. Deleted player pts. 10,616
  9. Avatar for aznarog 39. aznarog Lv 1 18 pts. 10,591
  10. Avatar for DodoBird 40. DodoBird Lv 1 17 pts. 10,584

Comments