Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697
  1. Avatar for cobaltteal 31. cobaltteal Lv 1 27 pts. 10,663
  2. Avatar for Museka 32. Museka Lv 1 26 pts. 10,652
  3. Avatar for joremen 33. joremen Lv 1 25 pts. 10,648
  4. Avatar for MicElephant 34. MicElephant Lv 1 23 pts. 10,640
  5. Avatar for frood66 35. frood66 Lv 1 22 pts. 10,631
  6. Avatar for TastyMunchies 36. TastyMunchies Lv 1 21 pts. 10,630
  7. Avatar for Simek 37. Simek Lv 1 20 pts. 10,616
  8. Avatar for Deleted player 38. Deleted player pts. 10,616
  9. Avatar for aznarog 39. aznarog Lv 1 18 pts. 10,591
  10. Avatar for DodoBird 40. DodoBird Lv 1 17 pts. 10,584

Comments