Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,684
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 10,518
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,400
  4. Avatar for freefolder 14. freefolder 1 pt. 10,199
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,091
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,913
  7. Avatar for I3L GANG 17. I3L GANG 1 pt. 9,484
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 9,425
  9. Avatar for GENE 433 19. GENE 433 1 pt. 9,310
  1. Avatar for Deleted player 41. Deleted player pts. 10,561
  2. Avatar for carsonfb 42. carsonfb Lv 1 15 pts. 10,547
  3. Avatar for Aminal88 43. Aminal88 Lv 1 14 pts. 10,518
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 14 pts. 10,507
  5. Avatar for guineapig 45. guineapig Lv 1 13 pts. 10,501
  6. Avatar for Vinara 46. Vinara Lv 1 12 pts. 10,492
  7. Avatar for NinjaGreg 47. NinjaGreg Lv 1 12 pts. 10,487
  8. Avatar for cbwest 48. cbwest Lv 1 11 pts. 10,479
  9. Avatar for pvc78 49. pvc78 Lv 1 10 pts. 10,473
  10. Avatar for stomjoh 50. stomjoh Lv 1 10 pts. 10,472

Comments