Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697
  1. Avatar for Deleted player 41. Deleted player pts. 10,561
  2. Avatar for carsonfb 42. carsonfb Lv 1 15 pts. 10,547
  3. Avatar for Aminal88 43. Aminal88 Lv 1 14 pts. 10,518
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 14 pts. 10,507
  5. Avatar for guineapig 45. guineapig Lv 1 13 pts. 10,501
  6. Avatar for Vinara 46. Vinara Lv 1 12 pts. 10,492
  7. Avatar for NinjaGreg 47. NinjaGreg Lv 1 12 pts. 10,487
  8. Avatar for cbwest 48. cbwest Lv 1 11 pts. 10,479
  9. Avatar for pvc78 49. pvc78 Lv 1 10 pts. 10,473
  10. Avatar for stomjoh 50. stomjoh Lv 1 10 pts. 10,472

Comments