Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,684
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 10,518
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,400
  4. Avatar for freefolder 14. freefolder 1 pt. 10,199
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,091
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,913
  7. Avatar for I3L GANG 17. I3L GANG 1 pt. 9,484
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 9,425
  9. Avatar for GENE 433 19. GENE 433 1 pt. 9,310

  1. Avatar for benrh 71. benrh Lv 1 3 pts. 10,178
  2. Avatar for alwen 72. alwen Lv 1 2 pts. 10,153
  3. Avatar for boondog 73. boondog Lv 1 2 pts. 10,114
  4. Avatar for Lyshi2018 74. Lyshi2018 Lv 1 2 pts. 10,091
  5. Avatar for monteecristo 75. monteecristo Lv 1 2 pts. 10,085
  6. Avatar for rabamino12358 76. rabamino12358 Lv 1 2 pts. 10,071
  7. Avatar for diamonddays 77. diamonddays Lv 1 2 pts. 10,060
  8. Avatar for toshiue 78. toshiue Lv 1 2 pts. 10,053
  9. Avatar for Merf 79. Merf Lv 1 1 pt. 10,025

Comments