Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697
  1. Avatar for benrh 71. benrh Lv 1 3 pts. 10,178
  2. Avatar for alwen 72. alwen Lv 1 2 pts. 10,153
  3. Avatar for boondog 73. boondog Lv 1 2 pts. 10,114
  4. Avatar for Lyshi2018 74. Lyshi2018 Lv 1 2 pts. 10,091
  5. Avatar for monteecristo 75. monteecristo Lv 1 2 pts. 10,085
  6. Avatar for rabamino12358 76. rabamino12358 Lv 1 2 pts. 10,071
  7. Avatar for diamonddays 77. diamonddays Lv 1 2 pts. 10,060
  8. Avatar for toshiue 78. toshiue Lv 1 2 pts. 10,053
  9. Avatar for Merf 79. Merf Lv 1 1 pt. 10,025
  10. Avatar for Alpha-KetoGlutarate1301 80. Alpha-KetoGlutarate1301 Lv 1 1 pt. 10,017

Comments