Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,684
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 10,518
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,400
  4. Avatar for freefolder 14. freefolder 1 pt. 10,199
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,091
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,913
  7. Avatar for I3L GANG 17. I3L GANG 1 pt. 9,484
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 9,425
  9. Avatar for GENE 433 19. GENE 433 1 pt. 9,310
  1. Avatar for harvardman 81. harvardman Lv 1 1 pt. 10,012
  2. Avatar for hansvandenhof 82. hansvandenhof Lv 1 1 pt. 9,928
  3. Avatar for ViJay7019 83. ViJay7019 Lv 1 1 pt. 9,924
  4. Avatar for SiPot2018 84. SiPot2018 Lv 1 1 pt. 9,923
  5. Avatar for Louis_LIB 85. Louis_LIB Lv 1 1 pt. 9,922
  6. Avatar for aspadistra 86. aspadistra Lv 1 1 pt. 9,913
  7. Avatar for abiogenesis 87. abiogenesis Lv 1 1 pt. 9,896
  8. Avatar for ti_go_Mars 88. ti_go_Mars Lv 1 1 pt. 9,877
  9. Avatar for tarimo 89. tarimo Lv 1 1 pt. 9,847
  10. Avatar for MrZanav 90. MrZanav Lv 1 1 pt. 9,749

Comments