Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697
  1. Avatar for harvardman 81. harvardman Lv 1 1 pt. 10,012
  2. Avatar for hansvandenhof 82. hansvandenhof Lv 1 1 pt. 9,928
  3. Avatar for ViJay7019 83. ViJay7019 Lv 1 1 pt. 9,924
  4. Avatar for SiPot2018 84. SiPot2018 Lv 1 1 pt. 9,923
  5. Avatar for Louis_LIB 85. Louis_LIB Lv 1 1 pt. 9,922
  6. Avatar for aspadistra 86. aspadistra Lv 1 1 pt. 9,913
  7. Avatar for abiogenesis 87. abiogenesis Lv 1 1 pt. 9,896
  8. Avatar for ti_go_Mars 88. ti_go_Mars Lv 1 1 pt. 9,877
  9. Avatar for tarimo 89. tarimo Lv 1 1 pt. 9,847
  10. Avatar for MrZanav 90. MrZanav Lv 1 1 pt. 9,749

Comments