Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups

  1. Avatar for Contenders 11. Contenders 3 pts. 9,784
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 9,413
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,238
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,072
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,015
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,862
  7. Avatar for dTech Biology 2018-2019 17. dTech Biology 2018-2019 1 pt. 7,464
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,054
  9. Avatar for freefolder 19. freefolder 1 pt. 5,961
  10. Avatar for MBB190 20. MBB190 1 pt. 5,295
  1. Avatar for nicobul 21. nicobul Lv 1 46 pts. 9,948
  2. Avatar for Steven Pletsch 22. Steven Pletsch Lv 1 44 pts. 9,946
  3. Avatar for vakobo 23. vakobo Lv 1 42 pts. 9,923
  4. Avatar for Susume 24. Susume Lv 1 41 pts. 9,920
  5. Avatar for Bruno Kestemont 25. Bruno Kestemont Lv 1 39 pts. 9,916
  6. Avatar for Timo van der Laan 26. Timo van der Laan Lv 1 37 pts. 9,895
  7. Avatar for andromeda72 27. andromeda72 Lv 1 36 pts. 9,878
  8. Avatar for drumpeter18yrs9yrs 28. drumpeter18yrs9yrs Lv 1 34 pts. 9,872
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 33 pts. 9,844
  10. Avatar for stomjoh 30. stomjoh Lv 1 31 pts. 9,832

Comments