Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,555
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,199
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 10,093
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,089
  6. Avatar for Go Science 6. Go Science 22 pts. 9,950
  7. Avatar for Hold My Beer 7. Hold My Beer 15 pts. 9,946
  8. Avatar for Russian team 8. Russian team 11 pts. 9,923
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,895
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,878
  1. Avatar for nicobul 21. nicobul Lv 1 46 pts. 9,948
  2. Avatar for Steven Pletsch 22. Steven Pletsch Lv 1 44 pts. 9,946
  3. Avatar for vakobo 23. vakobo Lv 1 42 pts. 9,923
  4. Avatar for Susume 24. Susume Lv 1 41 pts. 9,920
  5. Avatar for Bruno Kestemont 25. Bruno Kestemont Lv 1 39 pts. 9,916
  6. Avatar for Timo van der Laan 26. Timo van der Laan Lv 1 37 pts. 9,895
  7. Avatar for andromeda72 27. andromeda72 Lv 1 36 pts. 9,878
  8. Avatar for drumpeter18yrs9yrs 28. drumpeter18yrs9yrs Lv 1 34 pts. 9,872
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 33 pts. 9,844
  10. Avatar for stomjoh 30. stomjoh Lv 1 31 pts. 9,832

Comments