Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups

  1. Avatar for Contenders 11. Contenders 3 pts. 9,784
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 9,413
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,238
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,072
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,015
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,862
  7. Avatar for dTech Biology 2018-2019 17. dTech Biology 2018-2019 1 pt. 7,464
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,054
  9. Avatar for freefolder 19. freefolder 1 pt. 5,961
  10. Avatar for MBB190 20. MBB190 1 pt. 5,295
  1. Avatar for silent gene 41. silent gene Lv 1 19 pts. 9,527
  2. Avatar for joremen 42. joremen Lv 1 18 pts. 9,513
  3. Avatar for heather-1 43. heather-1 Lv 1 17 pts. 9,474
  4. Avatar for YeshuaLives 44. YeshuaLives Lv 1 16 pts. 9,460
  5. Avatar for fpc 45. fpc Lv 1 15 pts. 9,441
  6. Avatar for orily1337 46. orily1337 Lv 1 14 pts. 9,415
  7. Avatar for O Seki To 47. O Seki To Lv 1 14 pts. 9,413
  8. Avatar for manu8170 48. manu8170 Lv 1 13 pts. 9,381
  9. Avatar for jamiexq 49. jamiexq Lv 1 12 pts. 9,333
  10. Avatar for Aminal88 50. Aminal88 Lv 1 12 pts. 9,326

Comments