Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,555
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,199
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 10,093
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,089
  6. Avatar for Go Science 6. Go Science 22 pts. 9,950
  7. Avatar for Hold My Beer 7. Hold My Beer 15 pts. 9,946
  8. Avatar for Russian team 8. Russian team 11 pts. 9,923
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,895
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,878
  1. Avatar for silent gene 41. silent gene Lv 1 19 pts. 9,527
  2. Avatar for joremen 42. joremen Lv 1 18 pts. 9,513
  3. Avatar for heather-1 43. heather-1 Lv 1 17 pts. 9,474
  4. Avatar for YeshuaLives 44. YeshuaLives Lv 1 16 pts. 9,460
  5. Avatar for fpc 45. fpc Lv 1 15 pts. 9,441
  6. Avatar for orily1337 46. orily1337 Lv 1 14 pts. 9,415
  7. Avatar for O Seki To 47. O Seki To Lv 1 14 pts. 9,413
  8. Avatar for manu8170 48. manu8170 Lv 1 13 pts. 9,381
  9. Avatar for jamiexq 49. jamiexq Lv 1 12 pts. 9,333
  10. Avatar for Aminal88 50. Aminal88 Lv 1 12 pts. 9,326

Comments