Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups

  1. Avatar for Contenders 11. Contenders 3 pts. 9,784
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 9,413
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,238
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,072
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,015
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,862
  7. Avatar for dTech Biology 2018-2019 17. dTech Biology 2018-2019 1 pt. 7,464
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,054
  9. Avatar for freefolder 19. freefolder 1 pt. 5,961
  10. Avatar for MBB190 20. MBB190 1 pt. 5,295
  1. Avatar for navn 61. navn Lv 1 6 pts. 9,091
  2. Avatar for pfirth 62. pfirth Lv 1 6 pts. 8,919
  3. Avatar for johnmitch 63. johnmitch Lv 1 6 pts. 8,895
  4. Avatar for felixxy 64. felixxy Lv 1 5 pts. 8,864
  5. Avatar for cbwest 65. cbwest Lv 1 5 pts. 8,858
  6. Avatar for boondog 66. boondog Lv 1 5 pts. 8,800
  7. Avatar for Squirrely 67. Squirrely Lv 1 4 pts. 8,798
  8. Avatar for Merf 68. Merf Lv 1 4 pts. 8,788
  9. Avatar for jdmclure 69. jdmclure Lv 1 4 pts. 8,694
  10. Avatar for Dhalion 70. Dhalion Lv 1 4 pts. 8,682

Comments