Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,555
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,199
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 10,093
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,089
  6. Avatar for Go Science 6. Go Science 22 pts. 9,950
  7. Avatar for Hold My Beer 7. Hold My Beer 15 pts. 9,946
  8. Avatar for Russian team 8. Russian team 11 pts. 9,923
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,895
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,878
  1. Avatar for navn 61. navn Lv 1 6 pts. 9,091
  2. Avatar for pfirth 62. pfirth Lv 1 6 pts. 8,919
  3. Avatar for johnmitch 63. johnmitch Lv 1 6 pts. 8,895
  4. Avatar for felixxy 64. felixxy Lv 1 5 pts. 8,864
  5. Avatar for cbwest 65. cbwest Lv 1 5 pts. 8,858
  6. Avatar for boondog 66. boondog Lv 1 5 pts. 8,800
  7. Avatar for Squirrely 67. Squirrely Lv 1 4 pts. 8,798
  8. Avatar for Merf 68. Merf Lv 1 4 pts. 8,788
  9. Avatar for jdmclure 69. jdmclure Lv 1 4 pts. 8,694
  10. Avatar for Dhalion 70. Dhalion Lv 1 4 pts. 8,682

Comments